PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G149100.1
Common NameB456_007G149100, LOC105803233
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 479aa    MW: 52541.5 Da    PI: 5.6904
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G149100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.61.6e-34252306155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr+rWtpeLHe+Fveav+qLGGse+AtPk +l+lmkv+gLt++hvkSHLQkYR+
  Gorai.007G149100.1 252 KPRMRWTPELHEAFVEAVNQLGGSERATPKGVLKLMKVDGLTIYHVKSHLQKYRT 306
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.873249309IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-32250308IPR009057Homeodomain-like
SuperFamilySSF466892.69E-18250306IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-25252306IPR006447Myb domain, plants
PfamPF002494.5E-10254305IPR001005SANT/Myb domain
PfamPF143791.3E-24337382IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MEARPALSIQ RSGASQLSSL GVSGGLSSSL SIPSTHLEGT YQKLPDIQQV PSERELTTRP  60
QAHATRVPTN NGVVGHIFSS SSGFSSDLHY SSVLPNEKHS RNSPFISQSL ADTASLPLSQ  120
SSSSLLPQPT IPSCCNKENS GSWCTDPDFL DFPVSTPVQS GQVENIQRSE DFSKQNDWQE  180
WADQLITCDD ALTSNWNELL VDNVTNLEPK MACQVAKPCT TMPAQNQQLP SPSVESLRVV  240
NPSSSANNAP AKPRMRWTPE LHEAFVEAVN QLGGSERATP KGVLKLMKVD GLTIYHVKSH  300
LQKYRTARYR PESSEGSSEK KLTSMEEISS LDLKTGMGIT EALRLQMEVQ KRLHEQLEIQ  360
RNLQLRIEEQ GRYLQMMFEK QKSGLDKLKV SSSNPENPAA TSDATKEAPT KSELESSQRD  420
HLDSGTGTVN NAKSMLERSS REMGGEDMAT EAGDLEKTKA RVSETSPEQA AKRSRIEE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490737.10.0PREDICTED: protein PHR1-LIKE 1
RefseqXP_012490738.10.0PREDICTED: protein PHR1-LIKE 1
SwissprotQ8GUN51e-96PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A0D2QSY90.0A0A0D2QSY9_G
STRINGPOPTR_0002s25960.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.15e-99phosphate starvation response 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]